PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00147758001
Common NameGSBRNA2T00147758001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Nin-like
Protein Properties Length: 803aa    MW: 89606.6 Da    PI: 6.3334
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00147758001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK93.81.3e-29540591152
               RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                          aek+i+l++l++yF++++kdAAk++gvc+T+LKriCRq+GI+RWP+Rkik++
  GSBRNA2T00147758001 540 AEKNITLDVLRQYFAGSLKDAAKSIGVCPTTLKRICRQHGIQRWPSRKIKKV 591
                          589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.052528611IPR003035RWP-RK domain
PfamPF020421.2E-25543591IPR003035RWP-RK domain
SuperFamilySSF542771.62E-22694790No hitNo description
PROSITE profilePS5174529.03704787IPR000270PB1 domain
SMARTSM006669.9E-25704787IPR000270PB1 domain
CDDcd064071.46E-35705781No hitNo description
PfamPF005644.6E-18705785IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2404.2E-19705784No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 803 aa     Download sequence    Send to blast
MNNNYHLPMD PAMDSSFMDG LLLDGCWLET TTTDASEFPN FSPSTSISPF DPSSFMWSPQ  60
QDNTAAISSS TLSHMYGQGF AERSSLEDLS TLNRRLWIGP SGGGHGSSVM ERLVQAVKHI  120
KDFTSERGDS LIQLWVPVDR GGKRVLTTKE QPFSHDPMSQ RLAHYREISE NYQFSAEQED  180
SSSKDLVGLP GRVFLGQVPE WTPDVRFFKN EEYPRVQHAQ DCDVRGTLAI PVFEQGSKTC  240
IGVIEVVMTT QMVKLSPELD SICRALQAVD LRSTEVPVSP SLKGPDFSYQ AALPEIRNLL  300
RCACETHKLP LAQTWMSCLK QSKTGCRHND HNYIHCVSTI DDACYVGDPT VREFHEACSE  360
HHLLKGQGVV GEAFLTNGPC FSSDVSSYKK SEYPLSHHAT MFGLHGTVAI RLRCIHTGSA  420
DFVLEFFLPK DCRDIEEQRR MLNALSTIMA HVPRSLRTVT EKELEEEGDQ MVSEVETLPK  480
IEETCEVHGS NSNPQHVGLA VDGELGFDYG KGVSVVNENS TFSSGGGGSS RVTEKKKTKA  540
EKNITLDVLR QYFAGSLKDA AKSIGVCPTT LKRICRQHGI QRWPSRKIKK VGHSLQKIQR  600
VIDSVQGVSG HHLPIGSFYA NFPNLASSQE QQSKQTTFLP PSSHSQPAKS SSPGSSCSHT  660
SSCSSETQVN KDDPMNKARE DTRSFKQTQT TQLSPSTSSQ DDDFLRLKVS YEEEKIRFRM  720
RNSRRLKDLL WEIAKRFGIE DVSRYDLKYL DEDNEWVLLR CDDDVEECVD VCRSFPGETI  780
KLLLQLSSQH LQERSSISGS LS*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00147758001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013592002.10.0PREDICTED: protein NLP5 isoform X1
RefseqXP_013592003.10.0PREDICTED: protein NLP5 isoform X1
SwissprotQ9SFW80.0NLP5_ARATH; Protein NLP5
TrEMBLA0A078DIC70.0A0A078DIC7_BRANA; BnaC06g37080D protein
STRINGBra015758.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34612663
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76350.10.0Nin-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]